T5F17.90 At4g28640 Indoleacetic acid-induced protein 11 246 Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression. MEGGSASGSASALSNDENLVVSCEDSSSPIGNELELGLTLSLGRKGYRDCRVYADDSSSSSSSSSLSRASVIAGIKRTADSMAATSGQVVGWPPIRTYRMNSMVNQAKASATEDPNLEISQAVNKNRSDSTKMRNSMFVKVTMDGIPIGRKIDLNAHKCYESLSNTLEEMFLKPKLGSRTLETDGHMETPVKILPDGSSGLVLTYEDKEGDWMLVGDVPWGMFIGSVRRLRIMKTSEATGKAQMIL IAA11_ARATH Auxin-responsive protein IAA11 IAA11